DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG8586

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:121/278 - (43%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQFLEPNCGY-------PDISPKIMHGQNAE-NGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFV 74
            :.|...||||       || :.|..:.::.. .|..|||..||....    |.:|||||||.:.|
  Fly   165 ANFKYKNCGYSNPKGLIPD-NDKFPYSEDVSIFGEFPWMVGIFTGRQ----EFLCGGTLIHPRLV 224

  Fly    75 LSAAHCIKRDQI--LAVRLGE-----------HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQ 126
            ::.:|.:..:.:  |..|.|:           |..||   :.:...:..|...|..|||.:|.:.
  Fly   225 VTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSR---IKEIIMHSEFDPNSLYNDIALLLLD 286

  Fly   127 PIVKFNAVIRPICIITDPTKVPNVK------TFKAAGWGKTE--NETFSKVLKTVELNELNASEC 183
            ..::....|:|:|:  .|.:.|.:.      |..|.|||..|  ::....|||.:.|..:...||
  Fly   287 EPIRLAPHIQPLCL--PPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREEC 349

  Fly   184 YNMLWVNVTESQ-------ICA-GHPDGDTCAGDSGGPLIHPVYMDGSL-RYVQLGIISFG--SS 237
            ...|.....|::       ||| |.|..|||.||.|.||.  ..|.|.: ||..:||:|:|  .:
  Fly   350 QAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLF--CQMPGEMDRYQLVGIVSWGVECA 412

  Fly   238 LCNSPGVYTRLSSFIDWI 255
            :.:.|.||..:.....||
  Fly   413 VEDIPAVYVNVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 72/254 (28%)
Tryp_SPc 34..255 CDD:238113 71/253 (28%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 73/245 (30%)
Tryp_SPc 197..430 CDD:214473 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.