DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG18563

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:123/283 - (43%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLWP----GAMSQFLEPNCGYPDISPKIMH-----GQNAENGTNPWMAYIFKYNDKEVAELVCG 65
            |..||    ||.:     |.|.....||...     |:....|...|:..:|.   :||  .:.|
  Fly   106 ITYWPLKGSGAPT-----NDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFY---EEV--YLTG 160

  Fly    66 GTLIHKQFVLSAAH----CIKRDQILAVRLGE------HSSSRY--FAVTKAFRNKYFTTGSYSN 118
            |:||..:.:|:|||    .:..|:|: ||.||      :...:|  ..|.:..|::.|...|..|
  Fly   161 GSLISPKVILTAAHNTMNKMNEDRIV-VRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGIN 224

  Fly   119 DIGILRIQPIVKFNAVIRP-ICIITDPTKVPNV--KTFKAAGWG--KTENETFSKVLKTVELNEL 178
            ::.::    .||...|:.. |.::|.|::..:.  :....|||.  .:.:::..:::|.:||..|
  Fly   225 NVALI----FVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVL 285

  Fly   179 NASECYNMLWVNVT--------ESQICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISF 234
            :.:.|... :.|.|        .|.||| ...:.|.|.|..|..|...:..:....:.|.||:::
  Fly   286 DRTTCVAQ-FRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAW 349

  Fly   235 GSSLC--NSPGVYTRLSSFIDWI 255
            |.. |  :.||:||.::.|..||
  Fly   350 GMG-CGLDLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 62/254 (24%)
Tryp_SPc 34..255 CDD:238113 61/253 (24%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 61/237 (26%)
Tryp_SPc 147..371 CDD:214473 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.