DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG18478

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:281 Identity:83/281 - (29%)
Similarity:124/281 - (44%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSQFLEPNCGY--PD---ISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLS 76
            :.|..|..|||  ||   :...:..|| |:....||...:. :|    ..||.||:||....||:
  Fly    23 LQQIEELKCGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVI-HN----RSLVGGGSLITPDIVLT 81

  Fly    77 AAHCI--KRDQILAVRLGE---HSSSRYFAVTKAF-----RNKYFTTGSYSNDIGILRIQPIVKF 131
            |||.|  |..:.:.|..||   .|:...:...:||     .:|.|.....:|::.:|.:......
  Fly    82 AAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPL 146

  Fly   132 NAVIRPICIITDPTKVPNVKTFKAAGWGKTE-NET-FSKVLKTVELNELNASECYNM-----LWV 189
            ...|..||:.|....:.:.:.. .|||||.: ::| :..|||.::|..:....|.:.     |..
  Fly   147 TYKINTICLPTQKRSLSSTRCI-VAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQ 210

  Fly   190 NVT--ESQICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC---NSPGVYTRL 248
            |.|  ...||| |..|.|.|.||.||.|..|:..|.. ::.|:||:::|.. |   |.|..||.:
  Fly   211 NYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPK-QFEQIGIVNWGVG-CKEKNVPATYTDV 273

  Fly   249 SSFIDWILMVV-------DNY 262
            ..|..||:..:       |||
  Fly   274 FEFKPWIVQQIKENLYTPDNY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 71/244 (29%)
Tryp_SPc 34..255 CDD:238113 71/243 (29%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 71/240 (30%)
Tryp_SPc 50..280 CDD:214473 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.