DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG4650

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:131/277 - (47%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAEL--VCGGTLIHKQFVLS 76
            ||: ||:|:..||.      :.:|:.|.|.::|||||:      ..:||  |||||:|.::.||:
  Fly    18 PGS-SQYLDGRCGL------LTNGKIANNISSPWMAYL------HTSELLYVCGGTVITEKLVLT 69

  Fly    77 AAHCIKRDQILAVRLGEHSSS--------RYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNA 133
            ||||.:..:.|..|:||...:        ..:.|::.|.:..:.|.:.:|||.||.:...:.|:.
  Fly    70 AAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSK 134

  Fly   134 VIRPICII--TDPTK-VPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQ 195
            .||||||:  |...| :.|::....|.||...:...|...:..::....|:.|..:....:..||
  Fly   135 TIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQ 199

  Fly   196 ICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWILMVVD 260
            .|||..|...|..|...||...:......|||.:||.:.... |....|||.:.|..|:||.|..
  Fly   200 FCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQK-CKRASVYTDVLSHTDFILSVWR 263

  Fly   261 NYT--VRSPPKIQYRVW 275
            .|.  .:||     :.|
  Fly   264 QYRNGEKSP-----KTW 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 71/234 (30%)
Tryp_SPc 34..255 CDD:238113 71/233 (30%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 71/231 (31%)
Tryp_SPc 33..258 CDD:304450 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.