DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG9377

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:288 Identity:65/288 - (22%)
Similarity:121/288 - (42%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FLEPNCGYPD--ISPKI-----------MHG------------QNAENGTNPWMAYIFKYNDKEV 59
            ::|..|..||  .:|||           .|.            |.|:.|..||:..::..:    
  Fly    62 YMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSD---- 122

  Fly    60 AELVCGGTLIHKQFVLSAAHCIKRDQILAVRL--GEHSSS--------RYFAVTKAFRNKYFTTG 114
             ..:|.|.||....|::.|||::..::..|||  ||..::        :..:|.:...:..:|..
  Fly   123 -TYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQM 186

  Fly   115 SYSNDIGILRIQPIVKFNAV--IRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNE 177
            ..:::|.||.:.....|...  ::||| :..|..:.|......:||.:::....:.:.|...|..
  Fly   187 PLAHNIAILLVDKEKPFQLAPNVQPIC-LPPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYV 250

  Fly   178 LNASECYNMLWVNV-------TESQICAGHPDGDTCAGD---SGGPLIHPV--YMDGSLRYVQLG 230
            |...:|...|.:::       .:|.:|||...||...||   :..||:.|:  :.|   |:...|
  Fly   251 LPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDD---RFHLAG 312

  Fly   231 IISFGSSLCNSP---GVYTRLSSFIDWI 255
            ::: .::.|:.|   |:||.:..:..||
  Fly   313 LLT-RTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 58/271 (21%)
Tryp_SPc 34..255 CDD:238113 57/270 (21%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 57/245 (23%)
Tryp_SPc 105..339 CDD:214473 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.