DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG5390

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:272 Identity:79/272 - (29%)
Similarity:119/272 - (43%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGYPD---ISPKIMH--GQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI--K 82
            |||.:   :..||..  .|.||.|..|||..|.: .:..:....|||.||....||:||||:  |
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILR-EEGNLNLYECGGALIAPNVVLTAAHCVHNK 198

  Fly    83 RDQILAVRLGE----------HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRP 137
            :...:.||.||          ....||  |.:...::.|..||..||:.::.::........|:.
  Fly   199 QPSSIVVRAGEWDTQTQTEIRRHEDRY--VKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQT 261

  Fly   138 ICIITDPTKVPNV------KTFKAAGWGKT---ENETFSKVLKTVELNELNASECYNMLWVNVTE 193
            :|:       |||      ....|.||||.   ::..:..:||.|::..:...:|.    .|:.|
  Fly   262 VCL-------PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCE----TNLRE 315

  Fly   194 SQ-----------ICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC---NSPG 243
            ::           ||| |..|.|||.||.|.||:.|:....: |:...||:::|.. |   |.||
  Fly   316 TRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKN-RFKSAGIVAWGIG-CGEVNIPG 378

  Fly   244 VYTRLSSFIDWI 255
            ||..::....||
  Fly   379 VYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 74/259 (29%)
Tryp_SPc 34..255 CDD:238113 73/258 (28%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/254 (29%)
Tryp_SPc 153..390 CDD:214473 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.