DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:287 Identity:76/287 - (26%)
Similarity:125/287 - (43%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFKIILLWPGAMS----QFLEPNCGYPD--ISPKIMHGQNAENGTNPWMAYI-FKYNDKEVAELV 63
            :|.::.|...|:|    |.:.|.....|  |:.:|::|..|..|..|:...: |..|    ....
  Fly     3 VFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGN----GGWW 63

  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFR-NKYFT----TGSY------- 116
            |||::|...:||:||||..         |....:.|:..|  :| |..||    :|.:       
  Fly    64 CGGSIIAHDWVLTAAHCTN---------GASQVTIYYGAT--WRTNAQFTHTVGSGDFIQNHNWP 117

  Fly   117 ---SNDIGILRIQPIVKFNAVIRPICI--ITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELN 176
               .|||.::| .|.|.|..::..:.:  ..|...:.:.....|.|||.|...:....::.|:|.
  Fly   118 NQNGNDIALIR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQ 181

  Fly   177 ELNASECYNMLWVNVTESQICAGHPDG----------DTCAGDSGGPLIHPVYMDGSLRYVQLGI 231
            .::.|||          |:.....|||          .||:|||||||:  ::..|.|    :|:
  Fly   182 IISNSEC----------SRTYGTQPDGILCVSTSGGKSTCSGDSGGPLV--LHDGGRL----VGV 230

  Fly   232 ISFGS-SLCNS--PGVYTRLSSFIDWI 255
            .|:.| :.|.:  |..:||:::.:|||
  Fly   231 TSWVSGNGCTAGLPSGFTRVTNQLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 66/252 (26%)
Tryp_SPc 34..255 CDD:238113 66/251 (26%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 66/252 (26%)
Tryp_SPc 37..260 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.