DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:285 Identity:75/285 - (26%)
Similarity:125/285 - (43%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TIFKIILLWPGAMSQFLEP--------NCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAE 61
            |:..:.:....|..:.::|        ..|...|..:|.:|..|..|..|::..:...:|.  ..
  Fly     6 TVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDS--GG 68

  Fly    62 LVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNKY--------------FT 112
            ..|||::|...:|::||||..         |.||.:.|:......:.:|              :.
  Fly    69 WWCGGSIIGHTWVITAAHCTH---------GAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSDYN 124

  Fly   113 TGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK-----AAGWGK-TENETFSKVLK 171
            |.:.:|||.::. .|.|.|..:|..:.:   |.......:|.     |:|||: .::...|..|.
  Fly   125 TNNLNNDISLIN-TPHVDFWHLINKVEL---PDGNERHDSFAGWWALASGWGRPCDSCGVSDYLN 185

  Fly   172 TVELNELNASECYNMLWVNV-TESQICAGHPDG-DTCAGDSGGPLI-HPVYMDGSLRYVQLGIIS 233
            .|:...:...||.::...:| |::.||...|.| .||||||||||: |.       |...:|:.|
  Fly   186 CVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHD-------RSKLVGVTS 243

  Fly   234 F-GSSLCNS--PGVYTRLSSFIDWI 255
            | .:|.|.|  |..:||::|::|||
  Fly   244 FVAASGCTSGLPDGFTRVTSYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 68/247 (28%)
Tryp_SPc 34..255 CDD:238113 68/246 (28%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/247 (28%)
Tryp_SPc 43..271 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.