DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG40160

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:106/257 - (41%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NCGYPDISPKIMHGQNAENGTNPW-MAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK--RDQ 85
            |.|..|.:...:....|..|..|| :|.:...|    ....|.|:|||||.||:||||::  |..
  Fly   155 NTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGN----LSYFCAGSLIHKQVVLTAAHCVESLRTG 215

  Fly    86 ILAVRLGEHSSS--------RYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICI-I 141
            ...||.||..:.        :..:|.....:..:...|.:.|..::.:...|..:..|..||: .
  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQ 280

  Fly   142 TDPTKVPNVKTFKAAGWGKTENET---FSKVLKTVELNELNASECYNML-------WVNVTESQI 196
            .|....|....| :.||||....:   :|.::|.|.|..:..:.|...|       ...:..|.|
  Fly   281 QDDIPQPGNTCF-STGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFI 344

  Fly   197 CAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWI 255
            |||...| |||.||.|.||..|.......||.|.||:::|.. ||.  |..|..::....||
  Fly   345 CAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIG-CNDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 69/246 (28%)
Tryp_SPc 34..255 CDD:238113 69/245 (28%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 71/246 (29%)
Tryp_SPc 169..405 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.