DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Hayan

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:283 Identity:96/283 - (33%)
Similarity:131/283 - (46%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILA-- 88
            |...::..|:.|:..:.|..|.||.| .||....|...|||:||..:|||:||||:..|....  
  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAI-AYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF 440

  Fly    89 VRLG----EHSSSRYFAVT---------KAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICI 140
            ||||    |:....|..:.         .:..:||:       ||.||::....|.:.||||.|:
  Fly   441 VRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYY-------DIAILQLAEDAKESDVIRPACL 498

  Fly   141 ITDPTKVP-NVKTFKAAGWG--KTENETFSKVLKTVELNELNASEC----------YNMLWVNVT 192
            .||.:..| |.|.| .||||  ...|...||:|....|:.:.|.||          ...|...|.
  Fly   499 YTDRSDPPANYKYF-VAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVI 562

  Fly   193 ESQICAGHPD--GDTCAGDSGGPLIHPV-YMDGSLRYVQLGIISFG-SSLCNSPGVYTRLSSFID 253
            .||:||...:  .|.|.||||||||..: .:||:  |..:|:||.| .....:||:|||:|||:|
  Fly   563 ASQLCAADKNQRKDACQGDSGGPLILEIDDVDGT--YSIVGVISSGFGCATKTPGLYTRVSSFLD 625

  Fly   254 WILMVVDNYTVRSPPKIQYRVWP 276
            :|..:               |||
  Fly   626 YIEGI---------------VWP 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 91/253 (36%)
Tryp_SPc 34..255 CDD:238113 91/252 (36%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 91/253 (36%)
Tryp_SPc 385..630 CDD:238113 92/255 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.