DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG9673

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:113/255 - (44%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DISP--KIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQI----- 86
            :.||  :|:.|::...|..||.|.: :||...    ||.|.:|....:|:||||:....|     
  Fly    22 EASPQGRILGGEDVAQGEYPWSASV-RYNKAH----VCSGAIISTNHILTAAHCVSSVGITPVDA 81

  Fly    87 --LAVRLG---EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICI--ITD- 143
              ||||||   :::......|.....:..:  |::.:||.||.:...:.|:..|:.|.:  .|| 
  Fly    82 STLAVRLGTINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDIALPPTTDE 144

  Fly   144 -----PTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASEC-----YNMLWVNVTESQICA 198
                 ..::||......||||:..:.|.|...:....|.|:.|.|     |..      ||.:|.
  Fly   145 ETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYGY------ESVVCL 203

  Fly   199 GHPDGD-TCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWI 255
            ...:|: .|.||:|..:|..   |..||    |:.||....|.|  |.|.||:|.::.||
  Fly   204 SRAEGEGICRGDAGAAVIDD---DKVLR----GLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/247 (28%)
Tryp_SPc 34..255 CDD:238113 70/246 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/247 (28%)
Tryp_SPc 29..259 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.