DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and sphe

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:109/241 - (45%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRD------QILAVRL 91
            :||.|::|:.....:.|.:...|..     ||||:::.:..:|:.|||:.||      ..||.|:
  Fly    25 RIMGGEDADATATTFTASLRVDNAH-----VCGGSILSQTKILTTAHCVHRDGKLIDASRLACRV 84

  Fly    92 GEHSSSRYFAVTK-------AFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVP- 148
            |   |:..:|..|       |....|:   :.:|::.::.:...:.:...|..|.::.....:| 
  Fly    85 G---STNQYAGGKIVNVESVAVHPDYY---NLNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143

  Fly   149 NVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGH--PDGDTCAGDSG 211
            .......||||:|.:.|.|..::.:.|.....:.|.: .:.:..|...|..|  .:| ||.||.|
  Fly   144 EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLD-AYSDHDEQSFCLAHELKEG-TCHGDGG 206

  Fly   212 GPLIHPVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWI 255
            |..|:     |:   ..:|:.:|....|.|  |.|:.||||:.|||
  Fly   207 GGAIY-----GN---TLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 61/239 (26%)
Tryp_SPc 34..255 CDD:238113 61/238 (26%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/224 (26%)
Tryp_SPc 42..244 CDD:214473 56/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.