DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG31220

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:281 Identity:88/281 - (31%)
Similarity:128/281 - (45%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNCGYPDISPKIMHGQNAENGTNPWMAYIFKYN------DKEVAELVCGGTLIHKQFVLSAAHCI 81
            |:||.|..:.:::.|........||:|.:...|      |:|:.. .|||:||:.::||:||||:
  Fly    93 PDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVP-SCGGSLINTRYVLTAAHCV 156

  Fly    82 KRD--QILAVRLGEHSSSRY-FAVTKAFR------------------NKYFTTG-SYSNDIGILR 124
            ...  ||..||||||::|.. ..:::..|                  |.|.... ::.|||.::|
  Fly   157 TDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVR 221

  Fly   125 IQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTEN-ETFSKVLKTVELNELNASECYNMLW 188
            ::..|::.....|||::..|..:...|.: .||||||.. :|.|||||...:......||     
  Fly   222 LKEPVRYTMAYYPICVLDYPRSLMKFKMY-VAGWGKTGMFDTGSKVLKHAAVKVRKPEEC----- 280

  Fly   189 VNVTES----------QICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQ-----LGIISFGSS 237
               :|.          |||||..|. .||.||||.||     |..|.|..:     .||.|:|..
  Fly   281 ---SEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPL-----MGTSGRSYETITFLAGITSYGGP 337

  Fly   238 LCNS---PGVYTRLSSFIDWI 255
             |.:   |.|:||.:.|..||
  Fly   338 -CGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 82/269 (30%)
Tryp_SPc 34..255 CDD:238113 82/268 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 82/269 (30%)
Tryp_SPc 104..360 CDD:238113 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.