DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG8952

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:133/277 - (48%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TIFKIILLWPGAMSQFLEPNCGYP-DISPKIMHGQNAENGTNPWMAYIFKYNDKEVA--ELVCGG 66
            ::..::|.....:.|..:|....| .|..:|:.|.:|:.|..||...:     |..|  :|:|||
  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVIL-----KRDAWDDLLCGG 67

  Fly    67 TLIHKQFVLSAAHCIKRDQILAVRLGE---------HSSSRYFAVTKAFRNKYFTTGSYSNDIGI 122
            ::|...:||:||||......:.:..|.         :.:|....:...:.:|      .:||:.:
  Fly    68 SIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDK------LNNDVSL 126

  Fly   123 LRIQPIVKFNAVIRPICII----TDPTKVPNVKTFKAAGWGKTENE--TFSKVLKTVELNELNAS 181
            :::...:.|:|.|:.|.::    .....|.:|.|.  ||:|.||:|  .:|:.|...::..::.:
  Fly   127 IQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATI--AGFGYTEDEYLDYSETLLYAQVEIIDNA 189

  Fly   182 ECYNML--WVNVTESQICAGHPDG---DTCAGDSGGPLIHPVYMDGSLRYVQLGIISF-GSSLC- 239
            :|..:.  :| |.:|.:||...||   .||.||||||||  :|.....::.|:||.|| ....| 
  Fly   190 DCVAIYGKYV-VVDSTMCAKGFDGSDMSTCTGDSGGPLI--LYNKTIQQWQQIGINSFVAEDQCT 251

  Fly   240 -NSPGVYTRLSSFIDWI 255
             ..|..|.|:|||:.:|
  Fly   252 YRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/246 (28%)
Tryp_SPc 34..255 CDD:238113 70/245 (29%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 70/246 (28%)
Tryp_SPc 38..271 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.