DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG33127

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:271 Identity:71/271 - (26%)
Similarity:121/271 - (44%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YPDISPKIMHGQNAENGTNPWMAYIFKYN-DKEVAELVCGGTLIHKQFVLSAAHC---------- 80
            :.:|.|.|:.|.:.:...|  :.|:...: .:.....:||.::|.|:::|:||||          
  Fly    34 HAEIQPLIIDGYDVQGVDN--VPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGD 96

  Fly    81 ----------IKRDQILAVRLGEHSSSRY--FAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNA 133
                      |.|..:.|.::      ||  ||.|    ::.|...:.|::|.:|.:....::||
  Fly    97 AVGTPVYAGIINRSNVTAAQV------RYVDFAST----HRSFNGNAGSDNIALLHVSESFEYNA 151

  Fly   134 VIRPICIITDPTKVPNV------KTFKAAGWGKT--ENETFSKVLKTVELNELNASECYNMLWVN 190
            .::.|.:       |::      ||..|.|||.|  :.:.:||.|:......||::.|..:|..:
  Fly   152 RVQQIAL-------PDINDDYSNKTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPAD 209

  Fly   191 --VTESQICAGHPDGDTCAGDSGGPLIH-PVYMDGSLRYVQLGIISF-GSSLCNSPGVYTRLSSF 251
              :|..|:|:   ...||.||.|.|||: |:  .|....|.||..|: .....|.|.|||.:..:
  Fly   210 APLTAQQVCS---QVKTCYGDGGTPLIYWPI--TGPAELVGLGSWSYMPCGYANRPTVYTSVPPY 269

  Fly   252 IDWILMVVDNY 262
            |.||...:..|
  Fly   270 IGWIHQTIGAY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 66/256 (26%)
Tryp_SPc 34..255 CDD:238113 66/255 (26%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 68/258 (26%)
Tryp_SPc 41..273 CDD:214473 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.