DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and sphinx1

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:251 Identity:63/251 - (25%)
Similarity:105/251 - (41%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG-GTLIHKQFVLSAAHCIKRDQILAVRLGE 93
            :||:|..|..|:..|..::..|. |...:.:.|..| ||:|..|::|:....:|...| .|.|..
  Fly    22 LSPRIAGGYRAKTFTIIYLVGIV-YFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYI-EVHLAS 84

  Fly    94 HSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQ-PIVKFNAVIRPICIITDPTKVPNVKT-FK-- 154
            ..|.|.|.:.:.::..:  ...|.||..|..:: |..||:..:       |..:||...| |:  
  Fly    85 RRSYRGFDIIRIYKENF--RFHYDNDHVIALVKCPYQKFDRRM-------DRVRVPAYDTRFERY 140

  Fly   155 ------AAGWG-KTENETFSKVLKTVELNELNASEC---YNML-WVNVTESQICAGHPDGDTCAG 208
                  ..|:| :..:....:.::.:|:..:|.:||   |..| |..:..|    |......|.|
  Fly   141 VGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTS----GEGFKGVCEG 201

  Fly   209 DSGGPLI----HPVYMDGSLRYVQLGIISFGSSLCN--SPGVYTRLSSFIDWILMV 258
            |.||.::    :|.:         :|||......|:  .|.|:.|:|..|.||..|
  Fly   202 DIGGAVVTMGPNPTF---------IGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 58/243 (24%)
Tryp_SPc 34..255 CDD:238113 58/242 (24%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 58/243 (24%)
Tryp_SPc 26..248 CDD:304450 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.