DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and spirit

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:322 Identity:93/322 - (28%)
Similarity:133/322 - (41%) Gaps:83/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PGAMSQFLEPN---------------CGYPDISPKIMH-GQNAENGTN----------------- 45
            |.|::.:||..               |..|.::|.:.. .|.|.|..|                 
  Fly    70 PSALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVG 134

  Fly    46 ---------PWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHC--IKRDQILAVRLGEH---- 94
                     |:||.: ::.|..:.....|||.||...|||:||||  :..:....||||..    
  Fly   135 GMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTL 199

  Fly    95 SSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWG 159
            :.....::.:...:..::..:..|||.:|.::...|  ..::|.||.|.......:.|  |.|:|
  Fly   200 TEGEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEVTNTLVT--AIGYG 260

  Fly   160 KTENETFSKV-LKTVELNELNASECY-----NMLWVNVTESQICAGHPDG--DTCAGDSGGPLIH 216
            :|.....|.. |..|.|..::..||.     :.|...|..:|:|||...|  |||.|||||||: 
  Fly   261 QTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLL- 324

  Fly   217 PVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWILMVVDNYTVRSPPKIQYRVWP 276
              ..||.|.|| :||.|.|.. |.|  |.||||:|||:|||..:               |||
  Fly   325 --MQDGLLGYV-VGITSLGQG-CASGPPSVYTRVSSFVDWIEGI---------------VWP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 81/265 (31%)
Tryp_SPc 34..255 CDD:238113 81/264 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 5/27 (19%)
Tryp_SPc 132..364 CDD:238113 79/240 (33%)
Tryp_SPc 132..361 CDD:214473 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.