DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Prss30

DIOPT Version :10

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:15/31 - (48%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PVANGTAILGAHNRMIEEPSQQRITFSSSGV 152
            |..|...||.:...::.||:    |||.:.|
Mouse   116 PTQNVRTILLSVISLLNEPN----TFSPANV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 34..255 CDD:238113 10/31 (32%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 10/31 (32%)

Return to query results.
Submit another query.