DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG18420

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:281 Identity:85/281 - (30%)
Similarity:157/281 - (55%) Gaps:26/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIFTIFKIILLWPGAMSQFLEPNCGYPD---ISPKIMHGQNAENGTNPWMAYIFKYNDKEVAEL 62
            :.:.|:|.::     ..:|||:..||...   :.|:|::|:.|...::||||::...::    :.
  Fly    12 LLLLTVFPLL-----GSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSN----QF 67

  Fly    63 VCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSS-----RYFAVTKAFRNKYFTTGSYSNDIGI 122
            :||||||.::.||:||||...:..:.|||||::..     ....|.:.|:::::...:::|||.:
  Fly    68 ICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIAL 132

  Fly   123 LRIQPIVKFNAVIRPICIITDPT---KVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECY 184
            ||:...|.:.|.||||||:.|.:   .:.::|.....|||:||:...|..|:|::::...:..| 
  Fly   133 LRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC- 196

  Fly   185 NMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLS 249
              .:.:|..:|.|||:.:.:.|.||:|||:...|....:.|:||:| |:..:..|..|.|:|.:.
  Fly   197 --AFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVG-IAITNKRCQRPSVFTDVM 258

  Fly   250 SFIDWI--LMVVDNYTVRSPP 268
            |.|::|  :.:..|...|:.|
  Fly   259 SHIEFIRRIFLTQNGNDRNQP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 73/229 (32%)
Tryp_SPc 34..255 CDD:238113 73/228 (32%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 73/229 (32%)
Tryp_SPc 43..267 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463282
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.