DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG33226

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:131/269 - (48%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LEPNCGYPDIS--PKIMHGQNAENGTNPWMAYIFK--YNDKEVAELVCGGTLIHKQFVLSAAHCI 81
            |:|||....:.  .:|:.|.||:...:|||..|.:  |:       .|||:||...|||:||||.
  Fly    32 LDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYH-------FCGGSLISSLFVLTAAHCH 89

  Fly    82 KRDQILAVRLGEHS--------SSRYFA-------VTKAFRNKYFTTGSYSN-DIGILRIQPIVK 130
            .|.: |.||.|.:|        ||:|.:       |.:.|.:..:.  .|.| ||.:..:...|:
  Fly    90 SRYR-LKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYR--DYHNYDIALFLLAKPVR 151

  Fly   131 FNAVIRPICIITDPTK------VPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWV 189
            :|...||||::....|      :..|..|...||||||::..|.:|:|..|..|:...|..:...
  Fly   152 YNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDR 216

  Fly   190 NVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDW 254
            .:....|||||....||.|||||||...:...|..|.|..||||:|:..|....|:|.:..:.:|
  Fly   217 KIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNW 281

  Fly   255 ILMVVDNYT 263
            |..:|.|:|
  Fly   282 IRDIVHNFT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 82/245 (33%)
Tryp_SPc 34..255 CDD:238113 82/244 (34%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 84/247 (34%)
Tryp_SPc 47..282 CDD:214473 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.