DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG33458

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:272 Identity:79/272 - (29%)
Similarity:127/272 - (46%) Gaps:29/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFKIILLWPG---AMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGT 67
            :..:::|..|   ..|..||.:||....:.:|..|:::....|||:||: ..|.|    .:|||:
  Fly     7 LLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYL-HINSK----FICGGS 66

  Fly    68 LIHKQFVLSAAHCIK-RDQILAVRLGEHSSSR---------------YFAVTKAFRNKYFTTGSY 116
            |::..|||:||||.: ::..:.|||||:.:|:               |..:.|.....|.|...|
  Fly    67 LLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYY 131

  Fly   117 SNDIGILRIQPIVKFNAVIRPICIITDP---TKVPNVKTFKAAGWGKTENETFSKVLKTVELNEL 178
              ||.:.::...|.:...|||||::.:|   ..|..::.|...|||.|.....|..|:...:.::
  Fly   132 --DIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQI 194

  Fly   179 NASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPG 243
            :...|.......|..:.||||........|||||||...|....:.|:.|.||:|......:...
  Fly   195 DRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVS 259

  Fly   244 VYTRLSSFIDWI 255
            |:|.:.|:.:||
  Fly   260 VFTNILSYSNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/240 (29%)
Tryp_SPc 34..255 CDD:238113 70/239 (29%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 70/240 (29%)
Tryp_SPc 38..274 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.