DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG33461

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:269 Identity:97/269 - (36%)
Similarity:142/269 - (52%) Gaps:26/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAMSQFLEPNCG-YPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAA 78
            |:.|.|||.||| .|.:|.||::|..|..|..||||::     ......:|.|:||::.|||::|
  Fly    22 GSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFL-----HTPTYFLCAGSLINQWFVLTSA 81

  Fly    79 HCIKRDQILAVRLGEHS--------------SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIV 129
            |||:.|..|..||||::              :::.:.|...|:::.:....:|||||:||::..|
  Fly    82 HCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRV 146

  Fly   130 KFNAVIRPICIITD---PTKVPNVKTFKAAGWGKTE---NETFSKVLKTVELNELNASECYNMLW 188
            ::...|:||||...   ...|..:..|||.|||.|.   |...|:||..:.|.....::|..:..
  Fly   147 EYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFK 211

  Fly   189 VNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFID 253
            .|....|||||:.||:.|.||||||....|.:.|..|:||:||.||....|:...:.|.:..:..
  Fly   212 QNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGR 276

  Fly   254 WILMVVDNY 262
            ||..|||.|
  Fly   277 WIKKVVDWY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 81/241 (34%)
Tryp_SPc 34..255 CDD:238113 80/240 (33%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 81/241 (34%)
Tryp_SPc 42..281 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463337
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.