DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Prss45

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:290 Identity:81/290 - (27%)
Similarity:127/290 - (43%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIFTIFKIILLWP-----GAMSQFLEPNCG---YPDISPKIMHGQNAENGTN-PWMAYIFKYNDK 57
            :|...|..:||.|     |....:.||.||   :||         |.|...: ||.|.: :..||
Mouse    18 WILICFAALLLLPPRPNLGYNENYTEPVCGTPWWPD---------NLEESHHWPWEASL-QIEDK 72

  Fly    58 EVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGE-----HSSSRYFAVTKA---FRNKYFTTG 114
            .    ||||.||.:.:|:||||||:.::..:|.||.     :.||....:...   ...||:...
Mouse    73 H----VCGGALIDRSWVVSAAHCIQGNKEYSVMLGSSTLHPNGSSWTLKIPVGDIIIHPKYWGRN 133

  Fly   115 SYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK---AAGWGKTENETFSKVLKTVELN 176
            ...:||.:|.::..|.||..::|||:   |....|.|...   ..|||:.:..:.:::....||.
Mouse   134 FIRSDIALLCLETPVTFNKYVQPICL---PEHNFNFKVGTKCWVTGWGQVKQHSSAQLTPAPELW 195

  Fly   177 E-----LNASEC---------YNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYV 227
            |     ::...|         |..:...:.::.||..:...|.|.||.||||...:  ||  |::
Mouse   196 EAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPGGPLACEI--DG--RWI 256

  Fly   228 QLGIISFGSSLCNSP--GVYTRLSSFIDWI 255
            ..|:.|:..:....|  .||||::.:..||
Mouse   257 LAGVFSWEKACATVPNLSVYTRITKYTIWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 67/249 (27%)
Tryp_SPc 34..255 CDD:238113 67/248 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 67/240 (28%)
Tryp_SPc 59..286 CDD:214473 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.