DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30323

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:248 Identity:42/248 - (16%)
Similarity:78/248 - (31%) Gaps:99/248 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGTLIHKQFVLSAAHCI------------KRDQILAV-----RLGEHSSSRYFAVTKAFRNKYF 111
            |.|:|:...:|:::..|:            .|..:..|     ||.:.|....:.|.|...::..
  Fly    54 CAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDESA 118

  Fly   112 TTGSYSNDIGILRIQPIV---KFNAVIRPICIITDPTKVPNVKTF--KAAGWGKT---------- 161
            .:|  ..::.:|::...|   :|..::        |.|..| .|:  .:.|||:.          
  Fly   119 ISG--CTELALLKLDRGVTGQRFAMML--------PEKELN-STWLCNSLGWGRIYYVSYVYISA 172

  Fly   162 ----------------ENETFSKVLKTVELNELNASECYNMLWVNVTESQICAGHPD-------- 202
                            ::..:|..|..:...:::..||                .||        
  Fly   173 MCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYEC----------------KPDCSRCLCMT 221

  Fly   203 -----GDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPG--VYTRL 248
                 |:.|..|.|.||....::.|..|.|.         .|:..|  .||.:
  Fly   222 SYTGRGNMCQQDLGSPLFCDHFLYGVARRVH---------TCDDEGFMFYTNI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 42/248 (17%)
Tryp_SPc 34..255 CDD:238113 42/248 (17%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 42/248 (17%)
Tryp_SPc 45..272 CDD:214473 42/248 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.