DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30289

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:282 Identity:90/282 - (31%)
Similarity:135/282 - (47%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSQFLEPNCGYPDIS------PKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVL 75
            ||:.|..|||   ||      |.|..|.......||||..::       :...|||:||.:||||
  Fly    22 MSRLLVENCG---ISKDDPYVPNIFGGAKTNIQENPWMVLVW-------SSKPCGGSLIARQFVL 76

  Fly    76 SAAHCIKRDQILAVRLGE-------------HSSSRYFAVTKAFR--NKYFTTGSYSNDIGILRI 125
            :||||:..:. |.||||:             |...:::.::...:  ::.:...:..|||.:||:
  Fly    77 TAAHCVSFED-LYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRM 140

  Fly   126 QPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVN 190
            ...|:::..:||||::.. .::.::..|...|||:||...||::|....|..::.|.|.......
  Fly   141 SEAVEYSDYVRPICLLVG-EQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMDISYCNIKFNKQ 204

  Fly   191 VTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFID 253
            ...||||||....:||.|||||||....:....|...|.|::|:||..|  |..||||.:|...:
  Fly   205 ADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHRE 269

  Fly   254 WILMVVDNYTVRSPPKIQYRVW 275
            ||.    |..|:..|......|
  Fly   270 WIF----NKMVQFKPTGHTTFW 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/238 (32%)
Tryp_SPc 34..255 CDD:238113 75/237 (32%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 75/237 (32%)
Tryp_SPc 42..271 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.860

Return to query results.
Submit another query.