DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30288

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:269 Identity:89/269 - (33%)
Similarity:127/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLEPNCGYPDIS---PKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHC 80
            :.||.:||....:   .:|..|::|...:||||..:.     ...:.||||:||..:|||:|.||
  Fly    25 RLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVM-----ISGKAVCGGSLITARFVLTAEHC 84

  Fly    81 IKRDQILAVRLGEHSSSR-------YFAVTKAFRNKYFTTGSYSN---DIGILRIQPIVKFNAVI 135
            |. ...:.|||||:.:..       :....:|:.........:||   |||:||:|..|.|:..:
  Fly    85 IS-PMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYV 148

  Fly   136 RPICIITDPTKVPN---VKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTE---- 193
            ||||:|...|...|   :..|...|||...:......|:|..|.:|....|         |    
  Fly   149 RPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSC---------ERPGR 204

  Fly   194 ----SQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDW 254
                |.||||....|:|.|||||||......:|..|..|.|:.|.|..||:..|:||.::.|.||
  Fly   205 PLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGLGIYTNVTHFTDW 269

  Fly   255 ILMVVDNYT 263
            ||.|:.|::
  Fly   270 ILDVIQNHS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 80/242 (33%)
Tryp_SPc 34..255 CDD:238113 80/241 (33%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 80/242 (33%)
Tryp_SPc 45..270 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.