DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30287

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:131/276 - (47%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFTIFKIILLWPGAMSQFLEPNCGYPDISP---KIMHGQNAENGTNPWMAYIFKYNDKEVAELVC 64
            :..:..::.|........|:|.|......|   ::::|:.|:..:||||..|.     |...:.|
  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII-----ERGMMKC 67

  Fly    65 GGTLIHKQFVLSAAHCIKRDQI-LAVRLGEHSSS--------------RYFAVTKAFRNKYFTTG 114
            ||:||..::||:||||....:. |.||||::..:              |...||:.:...:: |.
  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY-TN 131

  Fly   115 SYSNDIGILRIQPIVKFNAVIRPICIIT-----DPTKVPNVKTFKAAGWGKTENETFSKVLKTVE 174
            ...|||.:||::..|::...||.||::.     ....:.|:..|...|||:||:...|.||:...
  Fly   132 FRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQAS 196

  Fly   175 LNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC 239
            |...:.|.|..:....:.:|.||.....|.||.|||||||...|.:....|.:..|::|:|:..|
  Fly   197 LTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261

  Fly   240 NSPGVYTRLSSFIDWI 255
            ..|.|||.:..|.:||
  Fly   262 FGPTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/241 (31%)
Tryp_SPc 34..255 CDD:238113 75/240 (31%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/241 (31%)
Tryp_SPc 42..280 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.