DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30286

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:165/278 - (59%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIFTIFKIILLW-PGAMSQFLEPNCGYPDISPKIMHGQNAEN----GTNPWMAYIFKYNDKEVA 60
            |:...:...:|.| |.|.:|||||:|||  :||:.:  ||.|:    ..:|||||:.|     ..
  Fly     1 MYWILLLTSLLPWHPHATAQFLEPDCGY--MSPEAL--QNEEHQAHISESPWMAYLHK-----SG 56

  Fly    61 ELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSS--------------SRYFAVTKAFRNKYF 111
            ||||||||::.:|:|:|||||:.|:.|.|||||.:|              |..|.:..|||:..:
  Fly    57 ELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGY 121

  Fly   112 TTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFK---AAGWGKTENETFSKVLKTV 173
            :..:..:|||:||:...|::...|:|||:||:.|..|.::...   |.|||::.:|..:.:||::
  Fly   122 SRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSI 186

  Fly   174 ELNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSL 238
            .:..:|...|....||:....|||..|..|.:|:||||||:...:.:||.:.:||:||:|:|::.
  Fly   187 RVTRVNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE 251

  Fly   239 CNSPGVYTRLSSFIDWIL 256
            |.||.|:|.:...||||:
  Fly   252 CLSPSVFTNVMEHIDWIM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 89/242 (37%)
Tryp_SPc 34..255 CDD:238113 89/241 (37%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 87/234 (37%)
Tryp_SPc 39..268 CDD:214473 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463279
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.