DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30091

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:263 Identity:91/263 - (34%)
Similarity:134/263 - (50%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQFLEPNCGYP-DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI 81
            ::.|:.:||.| .:.|||:.|.:|....|||||.| |.||    |.:|||::|..:|||:||||:
  Fly    20 ARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALI-KTND----EFICGGSVITNKFVLTAAHCM 79

  Fly    82 KRDQILAVR---------------LGEHS-SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVK 130
            ..|:...|:               .|||: ....:.|.:.:.:..|...:|.|||.:||:|..:.
  Fly    80 CTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIV 144

  Fly   131 FNAVIRPICIITDPTKVPN---VKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVT 192
            :...|:|:||:.:....|.   ::.|.|.|||.|.|...|..|:.|::..::...|....|....
  Fly   145 YKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFD 209

  Fly   193 ESQICAGHPDG-DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWIL 256
            ....|||...| |||..||||||...:..||..|..||||:|.|:..|...|:||.:...||:|.
  Fly   210 YPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIE 274

  Fly   257 MVV 259
            .:|
  Fly   275 RIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/241 (35%)
Tryp_SPc 34..255 CDD:238113 83/240 (35%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 84/241 (35%)
Tryp_SPc 37..276 CDD:238113 84/243 (35%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463349
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.