DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30088

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:269 Identity:102/269 - (37%)
Similarity:158/269 - (58%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLWPGAMSQFLEPNCGY---PDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHK 71
            ::|.....:.||.|:||.   .:::.:|:.|:.|...:.|:|||:: |:    :|:.||||:|..
  Fly    18 LVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLY-YS----SEIHCGGTIISS 77

  Fly    72 QFVLSAAHCIKRDQILAVRLGEHSSSR--------------YFAVTKAFRNKYFTTGSYSNDIGI 122
            :::|:||||::  ..|.||||||..:|              .|.:..|.:.|.|.. ..:|||.:
  Fly    78 RYILTAAHCMR--PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDR-FLANDIAL 139

  Fly   123 LRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNML 187
            |::...::||..|:|||:|.:|...|||..|:|.|||:||....:.||:|..|...:...|.::|
  Fly   140 LKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVL 204

  Fly   188 WVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFI 252
            .:.:|.:|:|.|....|||:|||||||:..|..||..||:||||:|||...|.||||||.:.::|
  Fly   205 SMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYI 269

  Fly   253 DWILMVVDN 261
            .||..|:.:
  Fly   270 RWIRYVMQS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 93/235 (40%)
Tryp_SPc 34..255 CDD:238113 93/234 (40%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 93/235 (40%)
Tryp_SPc 45..273 CDD:238113 94/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463298
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.790

Return to query results.
Submit another query.