DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30087

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:255 Identity:92/255 - (36%)
Similarity:152/255 - (59%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQFLEPNCGY---PDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAH 79
            :|||.|.||.   ...:.::::|:.|...:.|:|.|:   .:..:..  |||::::.:::|:|||
  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYV---TNNSLTH--CGGSILNSRYILTAAH 82

  Fly    80 CIKRDQILAVRLGEHS--------------SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVK 130
            |:..:  |.:|||||:              .|..:.:.||..::::...::.|||.:|::...:.
  Fly    83 CVFPN--LRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSIN 145

  Fly   131 FNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQ 195
            ||..|:||||:.:|...|:|.|::..|||:|:...|..:|:|.||...:|:.|.......:..:|
  Fly   146 FNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQ 210

  Fly   196 ICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSFIDWI 255
            |||||.:.|||||||||||:..|..||..||:||||:|:|.:.|.||||||.:.::|:||
  Fly   211 ICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 84/235 (36%)
Tryp_SPc 34..255 CDD:238113 84/234 (36%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 84/235 (36%)
Tryp_SPc 42..272 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463299
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.800

Return to query results.
Submit another query.