DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG30002

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:282 Identity:84/282 - (29%)
Similarity:130/282 - (46%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 W-PG---AMSQFLEPNCG-----YPDISPKIM--HGQNAENGTNPWMAYIFKYNDKEVAELVCGG 66
            | ||   ......:.:||     .|.:..:.|  .|:.:...:.||||::...:|.|:..  |||
  Fly    30 WTPGQRLVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCR--CGG 92

  Fly    67 TLIHKQFVLSAAHCIK---RDQILAVRLGEHSSS------------------RYFAVTKAFRNKY 110
            :||.:.|||:||||.|   |.:.:.|.|||...|                  ..|.:.|...::.
  Fly    93 SLISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEE 157

  Fly   111 FTTGSYSNDIGILRIQPIVKFNAVIRPICI-ITDPTKVPNV---KTFKAAGWGKTENETFSKVLK 171
            |.......||.::::...|.|...|||||: :||......:   :.|.|.||||||:..::.  .
  Fly   158 FNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYAN--S 220

  Fly   172 TVELNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGS 236
            |:|: ::...:|.:    ....|.:||.....|||.|||||||:....:.|..|.||.|::|.||
  Fly   221 TMEV-DIRTEKCTD----GRDTSFLCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGS 280

  Fly   237 SLCNS--PGVYTRLSSFIDWIL 256
            ..|.:  ...|..:.:::.|||
  Fly   281 QNCGAGHKAYYMDVPTYMPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/250 (30%)
Tryp_SPc 34..255 CDD:238113 75/249 (30%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 74/247 (30%)
Tryp_SPc 62..301 CDD:238113 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.