DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and Prss39

DIOPT Version :10

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_033381.1 Gene:Prss39 / 21755 MGIID:1270856 Length:367 Species:Mus musculus


Alignment Length:41 Identity:12/41 - (29%)
Similarity:17/41 - (41%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LPSRSDTRTFAGLMGTVSGYGIYSTANPALSDVLNYVLNPV 227
            |||.:....:..| |.:|....|...|...:...|:.|.||
Mouse   263 LPSTTGLSPYLSL-GCLSVRTFYHRLNSIYAQSKNHSLPPV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 34..255 CDD:238113 12/41 (29%)
Prss39NP_033381.1 Tryp_SPc 68..310 CDD:238113 12/41 (29%)

Return to query results.
Submit another query.