DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and try-1

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:255 Identity:77/255 - (30%)
Similarity:117/255 - (45%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHC 80
            |.::..:....|..:..:::.|..:...:.||...:.    ..:....|||:||...|||:||||
 Worm    40 AQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLL----SRLGHHRCGGSLIDPNFVLTAAHC 100

  Fly    81 IKRDQ---ILAVRLGEH--SSSRYFAVTKAFRNKYFTTGSYSN-DIGILRIQPIVKFNAVIRPIC 139
            ..:|:   ..:||:|.|  .|.....||....:.::..|..|: |..|:||.|.|..:...||||
 Worm   101 FAKDRRPTSYSVRVGGHRSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPIC 165

  Fly   140 IITDPTKVPNVKTFKAAGWGKT-ENETFS-KVLKTVE---LNELNASECYNMLWVNVTESQICAG 199
            :.:.|. |.| :.....|||.| |..:.| ..|:.:.   |:.|..|...|.:......|.:|||
 Worm   166 LPSLPA-VEN-RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAG 228

  Fly   200 HPDG--DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFIDWI 255
            :..|  |:|.|||||||:  ...||  .:...|::|:|....  ..||||..:.|...||
 Worm   229 YSYGKIDSCQGDSGGPLM--CARDG--HWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 73/236 (31%)
Tryp_SPc 34..255 CDD:238113 73/235 (31%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.