DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG43742

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:289 Identity:105/289 - (36%)
Similarity:148/289 - (51%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILLWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFV 74
            ::::..|.:|.|:.||.. .|:.::.:|..|.  |:.:||.:  ||:   :|..|||:|||||:|
  Fly    12 VVIYQNAFAQLLDENCKV-KITYRVANGHTAI--TSQFMAAL--YNN---SEFFCGGSLIHKQYV 68

  Fly    75 LSAAHCIKRDQILAVRLGEHSSSRYFAV--------TKAFRNKYFTTGSYSNDIGILRIQPIVKF 131
            |:||||::....:.|.|||::.|....|        .|...:..|....:.|||.:||::..|.|
  Fly    69 LTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIF 133

  Fly   132 NAVIRPICIITDPTKVP-NVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVNVTESQ 195
            .|.|||||||.|..... |...|.|.||||||:...|.||..::|..|..|.||..:      :.
  Fly   134 EAHIRPICIILDEDVTSNNQNNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMCYQNI------NT 192

  Fly   196 ICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSP-GVYTRLSSFIDWILMVV 259
            ||||...||||..|||||||......|..|.:..||.|:|.:.|:.. ||||.::::..||..||
  Fly   193 ICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASVV 257

  Fly   260 DNYTVRSPP-------------KIQYRVW 275
                :.|.|             ||..|:|
  Fly   258 ----LESEPRLLNEYCKSDWGAKIFLRLW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 89/231 (39%)
Tryp_SPc 34..255 CDD:238113 89/230 (39%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 89/231 (39%)
Tryp_SPc 35..256 CDD:238113 91/233 (39%)
Tryp_SPc 273..467 CDD:214473 4/10 (40%)
Tryp_SPc 273..>368 CDD:304450 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463401
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.