DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG43336

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:278 Identity:95/278 - (34%)
Similarity:147/278 - (52%) Gaps:29/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TIFKIILLWPGAMSQFLEPNCGY----PDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG 65
            |.|.:.||   ..:|||:..||.    |.: |::.:|..|...::||||::...:.:    .:||
  Fly     9 TFFLLPLL---GSTQFLDMACGIRAHSPSV-PRVKNGTVASLTSSPWMAFLHSTDGR----FICG 65

  Fly    66 GTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRY-------------FAVTKAFRNKYFTTGSYS 117
            |:||..:.||:||||......|..||||:....|             ..|.:.||::::...:.:
  Fly    66 GSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMA 130

  Fly   118 NDIGILRIQPIVKFNAVIRPICIITDP---TKVPNVKTFKAAGWGKTENETFSKVLKTVELNELN 179
            .||.|||:...|::...||||||:.||   ..:.::......||||||:|..|..|:||:|...:
  Fly   131 YDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKH 195

  Fly   180 ASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGV 244
            ...|.....:::|.:|.|||:...:.|.||||||:...:....|.|:||:||.||.::.|....|
  Fly   196 PEVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSV 260

  Fly   245 YTRLSSFIDWILMVVDNY 262
            :|.:.|::|||| .|.||
  Fly   261 FTDVMSYVDWIL-AVHNY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/237 (33%)
Tryp_SPc 34..255 CDD:238113 78/236 (33%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 78/237 (33%)
Tryp_SPc 40..271 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463288
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.700

Return to query results.
Submit another query.