DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30083 and CG42694

DIOPT Version :9

Sequence 1:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:282 Identity:85/282 - (30%)
Similarity:130/282 - (46%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TIFKIIL----LWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCG 65
            |:|..:|    |.....|:||:..||.|..:..|...:..:.|   |:|:|     .....::|.
  Fly     3 TLFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAG---WLAHI-----SNGTHVLCS 59

  Fly    66 GTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRNKYFTTGS-----------YSND 119
            |:||.||||||||.||.....|.|:||         |:.|.::.::.|.|           ...|
  Fly    60 GSLISKQFVLSAAQCIDVHGKLFVQLG---------VSNATKSPHWYTVSNVVIPSHSGKRLQRD 115

  Fly   120 IGILRIQPIVKFNAVIRPICIITDPTKVPNVK---TFKAAGW-GKTENETFSKVLKTVELNELNA 180
            ||:|::...|.:|..:.||||..:...:..||   .|..:.| .|.:|.      :|:.|::|:.
  Fly   116 IGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNP------QTIVLSQLSR 174

  Fly   181 SECYNMLWVNVTESQICAGH-PDGDTCAGDSGGPLIHPVYMDGS--LRYVQLGIISF--GSSLCN 240
            ..|...|..|||..:|||.. ...::|..|||..|..|: :.||  :|.:..||..:  |.|.|:
  Fly   175 DRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPI-IQGSNIVREMLFGIRGYVNGRSWCS 238

  Fly   241 SPGVYTRLSSFIDWILMVVDNY 262
            .|.:|..::..:.||..||..|
  Fly   239 EPAIYIDVAECVGWIETVVQQY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 70/241 (29%)
Tryp_SPc 34..255 CDD:238113 70/240 (29%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 70/230 (30%)
Tryp_SPc 46..253 CDD:214473 68/227 (30%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.