DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and f7

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:273 Identity:95/273 - (34%)
Similarity:131/273 - (47%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTINLP-----------PTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAH 80
            :|..|:|.|           ...|||||.....|..||.|.|..|...:|.||||...:|:||||
 Frog   188 SCEPTVNYPCGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGTLIAPNWVITAAH 252

  Fly    81 CLHSF--HLLTVRLGEYDTSTRIDCTSEFCIP--TYEEYSVENAYIHT-FFGGRQDSRNDIGLLK 140
            ||...  :.|||.|||:...|          |  |.:|..|....:|. ::|.:.::.|||.|||
 Frog   253 CLKPLPENKLTVVLGEHRIGT----------PEGTEQESKVSKIIMHEHYYGSKTNNDNDIALLK 307

  Fly   141 LNGTVVYKLFIRPICL------FRDPGQVPYSSTYEAAGWGKIDLINTAT--VLQTVNLIRLDQS 197
            |...|.|..::.|:||      .::...:.||:   .:|||:: |.:.||  :||.|.|.|:...
 Frog   308 LTTPVNYTDYVVPLCLPEKQFAVQELLSIRYST---VSGWGRL-LESGATPELLQRVQLPRVKTQ 368

  Fly   198 DCERSLRTSLSYGQFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGP-- 258
            ||.|..:.::|...||||  ....|:|.||||||.:.:..|....    .||||:|....:..  
 Frog   369 DCIRQTQMNISQNMFCAGYTDGSKDSCKGDSGGPHATQYKNTHFL----TGIVSWGLGCAKKEKY 429

  Fly   259 GVYTYVPSFTNWI 271
            ||||.|..:|.||
 Frog   430 GVYTRVSRYTEWI 442

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 90/249 (36%)
f7NP_001072819.1 Gla 67..107 CDD:459861
EGF_CA 108..144 CDD:238011