DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and TMPRSS2

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:268 Identity:78/268 - (29%)
Similarity:117/268 - (43%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCL-----HSFH- 86
            ||..:|....:|||||.:|..|:.||...||..:..||.|::||..:::|||||:     :.:| 
Human   281 CGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHW 345

  Fly    87 -----LLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVV 146
                 :|......|...                |.||....|..:..: ...|||.|:||...:.
Human   346 TAFAGILRQSFMFYGAG----------------YQVEKVISHPNYDSK-TKNNDIALMKLQKPLT 393

  Fly   147 YKLFIRPICLFRDPGQV--PYSSTYEAAGWGKI-------DLINTATVLQTVNLIRLDQSDCERS 202
            :...::|:|| .:||.:  |....: .:|||..       :::|.|.||    ||...:.:....
Human   394 FNDLVKPVCL-PNPGMMLQPEQLCW-ISGWGATEEKGKTSEVLNAAKVL----LIETQRCNSRYV 452

  Fly   203 LRTSLSYGQFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYTY 263
            ....::....|||  |...|:|.|||||||....:|    ....:|..|:|....:.  ||||..
Human   453 YDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNN----IWWLIGDTSWGSGCAKAYRPGVYGN 513

  Fly   264 VPSFTNWI 271
            |..||:||
Human   514 VMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 74/256 (29%)
TMPRSS2NP_001128571.1 LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:464747 1/1 (100%)
Tryp_SPc 293..524 CDD:238113 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.