DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and st14a

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:262 Identity:84/262 - (32%)
Similarity:124/262 - (47%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTINLPPTNRIVGGRTADIGSNPWLAYLH-KNSSLVCTGTLITKRFVLTAAHCLHSFHLL-- 88
            ||||  .....:|||||:.|..|..||...|| ||.:.||.|::|.:|:::|||||:.....:  
Zfish   586 NCGT--KAYKKSRIVGGQDAFEGEFPWQVSLHIKNIAHVCGGSIINERWIVTAAHCVQDDVKIKY 648

  Fly    89 ------TVRLGEYDTSTRIDCTSEF---CIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGT 144
                  .|.||.:....::..|...   .||    :...|||.:.         |||.|:::...
Zfish   649 SQPGTWEVFLGLHSQKDKLTATKRLLKQVIP----HPYYNAYTYD---------NDIALMEMESP 700

  Fly   145 VVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKI-DLINTATVLQTVNLIRLDQSDCERSLRTSLS 208
            |.:...|||:||.......|..::...:|||.. :..:.|||||...:..::.:.|.:.:...::
Zfish   701 VTFSDTIRPVCLPTATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQIT 765

  Fly   209 YGQFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCR--GPGVYTYVPSFTN 269
            ....|||  ....|.|.||||||||  ..:|:  |....|:||:|....|  .||:|:.||.|..
Zfish   766 SRMTCAGVLSGGVDACQGDSGGPLS--FPSGK--RMFLAGVVSWGDGCARRNKPGIYSNVPKFRA 826

  Fly   270 WI 271
            ||
Zfish   827 WI 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 79/249 (32%)
st14aNP_001035441.2 PknB_PASTA_kin <1..>69 CDD:468045
SEA 77..168 CDD:460188
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 597..831 CDD:238113 79/249 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.