DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:277 Identity:90/277 - (32%)
Similarity:125/277 - (45%) Gaps:64/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNS--SLVCTGTLITKRFVLTAAHCLH-SFHLLT 89
            ||   ..|...:||||:.|..||.||...|...:  ...|.|:||.|.:||:||||.. |...:.
Zfish    27 CG---RAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIGTIM 88

  Fly    90 VRLG--------EYD-TSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTV 145
            |:||        .|. |.|.:...:.   |.|...|               :.|||.|:||:.:|
Zfish    89 VKLGLQSQSGSNPYQITKTVVQVINH---PNYNNPS---------------NDNDIALVKLDSSV 135

  Fly   146 VYKLFIRPICLFRDPGQVPYSSTYEA------AGWGKIDLI--NTATVLQTVNLIRLDQSDCERS 202
            .:..:|.|:||      ....:||.|      .||||:...  ....:||.|.:..:..|||:|:
Zfish   136 TFNDYIEPVCL------AAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRA 194

  Fly   203 LRTSLSYGQFCAG---QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG------P 258
            ....::....|||   |...|:|.||||||:..:  ||  ::.:|.||||:|    ||      |
Zfish   195 YPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSR--NG--SQWIQSGIVSFG----RGCAEPGYP 251

  Fly   259 GVYTYVPSFTNWILSIT 275
            |||..|..:.:||.|.|
Zfish   252 GVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 83/260 (32%)
Tryp_SPc 40..274 CDD:238113 85/262 (32%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 83/260 (32%)
Tryp_SPc 36..264 CDD:238113 83/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.