DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG18754

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:265 Identity:92/265 - (34%)
Similarity:121/265 - (45%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PN---CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCL----- 82
            ||   ||.|   .|..|..|...|::...||:..|...:.|    :||  |:|||||||:     
  Fly    92 PNKQTCGQT---TPVFRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYL 147

  Fly    83 --HSFHLLTVRLGEYDTSTRIDC-TSEFCIPTYEEYSVENAYIHTFF---GGRQDSRNDIGLLKL 141
              :...|.:|||||..|    || |||...| :.:..|....:|..|   ||..  ||||.||:|
  Fly   148 TQNDLVLKSVRLGESTT----DCITSESRCP-HLDVEVGQTTVHQGFTSSGGTY--RNDIALLRL 205

  Fly   142 NGTVVYKLFIRPICLFRDPGQVPYSS-TYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRT 205
            ...|.|...|:||||.  ..:.|... ..:.:||   |...::..|.|..:...:.:||.....:
  Fly   206 QFPVRYTKKIQPICLL--DAEFPLQDLNLQISGW---DPTKSSQTLITSTVKERNPADCLNRYPS 265

  Fly   206 SLSYGQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG---PGVYTYVPS 266
            ..|..|.|| ||.:.|||:|.||.|:...|.:|........||.|||...|..   |||||.:..
  Fly   266 FRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGH 330

  Fly   267 FTNWI 271
            |:.||
  Fly   331 FSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 84/247 (34%)
Tryp_SPc 40..274 CDD:238113 85/248 (34%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 85/246 (35%)
Tryp_SPc 108..335 CDD:214473 83/244 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.