DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG34458

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:107/246 - (43%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTR-I 101
            :||:||:.|..|..|....|..|....|.|:||:...::|||||         .:|:.....: |
  Fly    30 SRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHC---------TMGQNPGQMKAI 85

  Fly   102 DCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS 166
            ..|::......:.:::....||..: ..|....|:.|:||:..|.....::.|.|..........
  Fly    86 VGTNDLSAGNGQTFNIAQFIIHPRY-NPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAAD 149

  Fly   167 STYEAAGWGKIDLINTATVLQTVNLIRLDQSD------CERSLRTSLSYGQFCAG--QWRADTCS 223
            :....:|:|.|:     ..||..|.::..|..      |.......|:....|||  ..:..:|.
  Fly   150 TMAMISGFGAIN-----QNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQ 209

  Fly   224 GDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RG-PGVYTYVPSFTNWI 271
            |||||||:   .:|::     .|:||:| :.|  :| |.:||||.:..:||
  Fly   210 GDSGGPLT---VDGKL-----FGVVSWG-FGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 63/243 (26%)
Tryp_SPc 40..274 CDD:238113 64/244 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 63/243 (26%)
Tryp_SPc 32..254 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.