DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG34409

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:300 Identity:90/300 - (30%)
Similarity:133/300 - (44%) Gaps:81/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TTINLPP-------------TNRIVGGRTADIGSNPWL---AYLHKNSSLV---CTGTLITKRFV 75
            ||.::||             .:|::||..|..|..|||   ||.:::||.:   |:|:||:...:
  Fly   227 TTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHI 291

  Fly    76 LTAAHC----LHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDI 136
            :|||||    :....|..||||..|.:|              .:::|...:|..: .:....|||
  Fly   292 VTAAHCVVNLVSDLELSHVRLGSQDGAT--------------PFAIEQVIVHPNY-DQPKYANDI 341

  Fly   137 GLLKLNGTVVYKLFIRPICL-FRDP--------GQVPYSSTYEAAGW--------GKIDLINTAT 184
            .||::|.|   .....|||| |..|        ||:..     ||||        ..:|..|:..
  Fly   342 ALLRINST---NGTFTPICLPFNGPITLGNRLIGQIGV-----AAGWSIGSTENNSSMDPSNSTA 398

  Fly   185 VLQTVNLIRLDQSDCE---RSLRTS------LSYGQFCA-GQWRADTCSGDSGGPLSRKMSN--- 236
            .::.:.|..::.:.|.   .||..:      ::....|| |....|.|.||||||.....::   
  Fly   399 GVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVF 463

  Fly   237 GRITRTVQLGIVSYGHYLCRG----PGVYTYVPSFTNWIL 272
            |...|...:|||::|..|| |    |||||.|.||::|||
  Fly   464 GTSGRYTIIGIVAFGPTLC-GVTTIPGVYTLVSSFSDWIL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 83/275 (30%)
Tryp_SPc 40..274 CDD:238113 84/276 (30%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 83/275 (30%)
Tryp_SPc 252..501 CDD:238113 82/272 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.