DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG34436

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:259 Identity:82/259 - (31%)
Similarity:121/259 - (46%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLA-YLHKNSSLVCTGTLITKRFVLTAAHCLHS 84
            ||.:|.||.....|  :|.|       |.|.||:| .|..|.:  |:|.||.|.||:|:|.|:.:
  Fly    20 AQLLDQNCAEVSRL--SNDI-------IFSRPWMALVLLPNKT--CSGALIHKYFVITSASCVFN 73

  Fly    85 FHLLTVRLGEYDTSTRIDCTSEFCIP-TYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYK 148
            .....||||:      :....|..:. :.::|.|::||||.|: .:.:..:||.||:|...|:||
  Fly    74 QERAIVRLGQ------LSIKQEHIVSYSSDDYHVQSAYIHRFY-EKSNFEHDIALLELQNDVLYK 131

  Fly   149 LFIRPICLFRDPGQVPYS--STYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQ 211
            ..||||||:.|...:...  ..||...|| ||........:|..:..:.|..||.:.:.......
  Fly   132 AHIRPICLWLDKSDIDTQMFKRYETFRWG-IDEKYILPAAKTSKIKHISQVKCENAFKLYPQNSH 195

  Fly   212 FCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGH-YLCRGPGVYTYVPSFTNWILSI 274
            .|||......|. ::|.||.:|:......|....||.|||. ..|    :||.|..:.:||:.:
  Fly   196 ICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC----LYTDVTKYIDWIMGV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 73/236 (31%)
Tryp_SPc 40..274 CDD:238113 75/238 (32%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 72/226 (32%)
Tryp_SPc 40..251 CDD:214473 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.