DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and KLK6

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:239 Identity:75/239 - (31%)
Similarity:113/239 - (47%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRID 102
            |::|.|...|..|:|:.|.|:.:..|:|.|.||...:|||||||...  .|.|.||:::...|..
Human    20 NKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKP--NLQVFLGKHNLRQRES 82

  Fly   103 CTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS 167
                    :.|:.||..|.||..:......: ||.||:|.........|:|:.|.||..  ..::
Human    83 --------SQEQSSVVRAVIHPDYDAASHDQ-DIMLLRLARPAKLSELIQPLPLERDCS--ANTT 136

  Fly   168 TYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAG--QWRADTCSGDSGGPL 230
            :....||||....:....:|...:..:.:.:||.:....::....|||  ::..|:|.|||||||
Human   137 SCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPL 201

  Fly   231 SRKMSNGRITRTVQLGIVSYGHYLC---RGPGVYTYVPSFTNWI 271
                    :......|:||:|:..|   ..|||||.|..:||||
Human   202 --------VCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 72/236 (31%)
Tryp_SPc 40..274 CDD:238113 74/237 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.