DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:264 Identity:85/264 - (32%)
Similarity:122/264 - (46%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNS--SLVCTGTLITKRFVLTAAHCLHSFHLLT- 89
            ||..    |.|...||..|..||.||.|.:|:.|  ..:|.|:||.|.:||:||||.    ::| 
Zfish    27 CGQA----PLNNNNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCF----MITA 83

  Fly    90 -----VRLG-EYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYK 148
                 :.|| ::.|.:.         |.....::....||..: ......|||.||:|:.:|.:.
Zfish    84 TANIKIFLGRQFQTGSN---------PNEISRTLTQIVIHPDY-STTTQNNDIALLRLSSSVTFT 138

  Fly   149 LFIRPICLFRDPGQVPYSSTYEAAGWGK--IDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQ 211
            .:|||:||..........:.....||.|  ...|....|||.|.|..:..::|....:..::...
Zfish   139 DYIRPVCLASADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGIITDNM 203

  Fly   212 FCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHY--LCRGPGVYTYVPSFTNWIL 272
            .|||  :...|.|.||||||:..:  ||  :|.:|.||||:|..  |.|.||:||.|..:.:||.
Zfish   204 ICAGINEGGKDACQGDSGGPMVSQ--NG--SRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWIT 264

  Fly   273 SITR 276
            |..|
Zfish   265 SELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 77/246 (31%)
Tryp_SPc 40..274 CDD:238113 79/248 (32%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 77/243 (32%)
Tryp_SPc 37..263 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.