DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and PLAT

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:291 Identity:93/291 - (31%)
Similarity:141/291 - (48%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KLRAQFID-PNCGTTINL----PPTNRIVGGRTADIGSNPWLAYL---HKNS---SLVCTGTLIT 71
            :|..::.| |:| :|..|    .|..||.||..|||.|:||.|.:   |:.|   ..:|.|.||:
Human   285 RLTWEYCDVPSC-STCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILIS 348

  Fly    72 KRFVLTAAHCLHSF---HLLTVRLGEYDTSTRIDCTSEFCIPTYEE--YSVENAYIHTFFGGRQD 131
            ..::|:||||....   |.|||.||.   :.|:       :|..||  :.||...:|..|.  .|
Human   349 SCWILSAAHCFQERFPPHHLTVILGR---TYRV-------VPGEEEQKFEVEKYIVHKEFD--DD 401

  Fly   132 S-RNDIGLLKLNG----TVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINT--ATVLQTV 189
            : .|||.||:|..    .......:|.:||.....|:|..:..|.:|:||.:.::.  :..|:..
Human   402 TYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA 466

  Fly   190 NLIRLDQSDC--ERSLRTSLSYGQFCAGQWRA--------DTCSGDSGGPLSRKMSNGRITRTVQ 244
            ::.....|.|  :..|..:::....|||..|:        |.|.|||||||. .:::||:|   .
Human   467 HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLV-CLNDGRMT---L 527

  Fly   245 LGIVSYGHYLCRG----PGVYTYVPSFTNWI 271
            :||:|:|  |..|    |||||.|.::.:||
Human   528 VGIISWG--LGCGQKDVPGVYTKVTNYLDWI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 85/264 (32%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967
KR 125..209 CDD:238056
Kringle 215..296 CDD:395005 3/10 (30%)
Tryp_SPc 313..559 CDD:238113 84/262 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.