DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:109/270 - (40%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPPT--------NRIVGGRTADIGSNPWLAYL--HKNSSLVCTGTLITKRFVLTAAHCLHSFHLL 88
            |.||        .||..|..|..|..|::..|  ..|.:..|.|::|...:|||||||.:....:
  Fly    24 LVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV 88

  Fly    89 TVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYI--HTFFGGRQDSRNDIGLLKLNGTVVYKLFI 151
            |:   .|..|.|..       |.|..:.....::  |.:..|  :..|||.|::......:.|. 
  Fly    89 TI---NYGASLRNQ-------PQYTHWVGSGNFVQHHHYNSG--NLHNDISLIRTPHVDFWHLV- 140

  Fly   152 RPICLFRDPGQVP-YSSTYE--------AAGW-GKIDLINTATVLQTVNLIRLDQSDCERSLRTS 206
                   :..::| |:..|:        |:|| |..|.......||.|::..:.||||.||  .|
  Fly   141 -------NKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRS--WS 196

  Fly   207 LSYGQFC----AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY----GHYLCR--GPGVY 261
            |.....|    .|:   .||.|||||||.....|..:      |:.|:    |   |:  .|.|:
  Fly   197 LHDNMICINTNGGK---STCGGDSGGPLVTHEGNRLV------GVTSFVSSAG---CQSGAPAVF 249

  Fly   262 TYVPSFTNWI 271
            :.|..:.:||
  Fly   250 SRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/255 (27%)
Tryp_SPc 40..274 CDD:238113 70/256 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 69/255 (27%)
Tryp_SPc 38..262 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.