DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG9733

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:273 Identity:95/273 - (34%)
Similarity:135/273 - (49%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PNCGTTINLPPTNRIVGGRTADIGSNPWLAYLH------KNSSLVCTGTLITKRFVLTAAHCL-- 82
            |:||   .:...|||..|:..|:...||:..|.      ...|..|.|:||.:|:||||||||  
  Fly   151 PSCG---GVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTG 212

  Fly    83 ----HSFHLLTVRLGEYDTSTRIDCT--SEFCIPTYEEYSVENAYIHTFFGGRQDSR-NDIGLLK 140
                ....|::|||||:||.|.:||.  ...|.|..:....|...:|..:..:..:: :||||::
  Fly   213 RIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIR 277

  Fly   141 LNGTVVYKLFIRPICLFRDPGQVPYSS-----TYEAAGWGKIDLINTATVLQTVNLIRLDQSDCE 200
            :...|.|...|:||||   |..|...|     .:..||||:...:..:.|.|.|.:..:|.:.|.
  Fly   278 MERNVRYSDNIQPICL---PSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCR 339

  Fly   201 R---SLRTSLSYGQFCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC---RGP 258
            :   .::.:|...|.|| ||:|.|:|.|||||||.|......:..    ||||:| |.|   ..|
  Fly   340 QRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLE----GIVSFG-YKCGLKDWP 399

  Fly   259 GVYTYVPSFTNWI 271
            ||||.|.::..||
  Fly   400 GVYTNVAAYDIWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 89/258 (34%)
Tryp_SPc 40..274 CDD:238113 90/259 (35%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 89/258 (34%)
Tryp_SPc 162..415 CDD:238113 90/259 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.